PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g06640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 300aa    MW: 33355.4 Da    PI: 8.3748
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g06640genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.11.6e-20219253135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  Tp1g06640 219 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 253
                *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.9E-19213263IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.229213249IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.57E-15215276No hitNo description
Gene3DG3DSA:3.30.50.102.6E-15217250IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.50E-17218267No hitNo description
PROSITE patternPS003440219244IPR000679Zinc finger, GATA-type
PfamPF003202.5E-18219253IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MNWLPEEDFK GLSDDFFDDL INHIDFPLED IDATNAEGDW DAKFQDLEPP PMDMFPTFPS  60
EFTSCGVSTK AGRVGIHKTV PTSKQSLSSE ALSGINSTLH QSSSPPDIKV SKLFQSSSPV  120
SVLESSDGSF SPQNSRSQRL TFPVKGMRSK RKRPTTLRFK YLYPFELSKP EKSTAGESES  180
VTYYSLEQHA KKKRKISPTS HTMSSSLEAC NADGIARKCT HCETTKTPQW REGPNGPKTL  240
CNACGVRFRS GRLVPEYRPA SSPTFIPSVH SNSHRKIIEM RRKDGDQFDT SIIHAVISGA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304051.11e-168hypothetical protein CARUB_v10009871mg
RefseqXP_006304052.11e-168hypothetical protein CARUB_v10009871mg
SwissprotQ6DBP81e-163GAT11_ARATH; GATA transcription factor 11
TrEMBLR0IF881e-168R0IF88_9BRAS; Uncharacterized protein
STRINGBra018665.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-155GATA transcription factor 11